RAB15 antibody (N-Term)

Catalog No. ABIN634404

Product Details anti-RAB15 Antibody

Target: RAB15 (RAB15, Member RAS Onocogene Family (RAB15))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB15 antibody was raised against the N terminal of RAB15

Purification: Affinity purified

Immunogen: RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB15 Blocking Peptide, catalog no. 33R-8810, is also available for use as a blocking control in assays to test for specificity of this RAB15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB15

Target: RAB15 (RAB15, Member RAS Onocogene Family (RAB15))

Alternative Name: RAB15 (RAB15 Products)

Synonyms: si:dkey-263p20.2 antibody, zgc:86635 antibody, 2310012G06Rik antibody, AI840042 antibody, RAB15, member RAS oncogene family antibody, RAB15, member RAS oncogene family S homeolog antibody, rab15 antibody, rab15.S antibody, RAB15 antibody, Rab15 antibody

Background: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Molecular Weight: 23 kDa (MW of target protein)