RGS6 antibody (C-Term)

Catalog No. ABIN634403

Product Details anti-RGS6 Antibody

Target: RGS6 (Regulator of G-Protein Signaling 6 (RGS6))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RGS6 antibody was raised against the C terminal of RGS6

Purification: Affinity purified

Immunogen: RGS6 antibody was raised using the C terminal of RGS6 corresponding to a region with amino acids SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY

Application Details

Application Notes: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS6 Blocking Peptide, catalog no. 33R-8297, is also available for use as a blocking control in assays to test for specificity of this RGS6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-RGS6 antibody (ABIN634403)

Gao, Shen, Gonzalez, Dong, Kannan, Hoang, Eisinger, Pandey, Javadi, Chang, Wang, Overstreet-Wadiche, Zhao: "RGS6 Mediates Effects of Voluntary Running on Adult Hippocampal Neurogenesis." in: Cell reports, Vol. 32, Issue 5, pp. 107997, (2020) (PubMed).

Target Details for RGS6

Target: RGS6 (Regulator of G-Protein Signaling 6 (RGS6))

Alternative Name: RGS6 (RGS6 Products)

Synonyms: RGS6 antibody, DKFZp459O0734 antibody, GAP antibody, hm:zeh0300 antibody, si:ch211-268e23.2 antibody, regulator of G protein signaling 6 antibody, regulator of G-protein signaling 6 antibody, regulator of G-protein signaling 6 S homeolog antibody, RGS6 antibody, Rgs6 antibody, rgs6.S antibody, rgs6 antibody

Background: Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling