DIRAS1 antibody (N-Term)
-
- Target See all DIRAS1 Antibodies
- DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DIRAS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DIRAS1 antibody was raised against the N terminal of DIRAS1
- Purification
- Affinity purified
- Immunogen
- DIRAS1 antibody was raised using the N terminal of DIRAS1 corresponding to a region with amino acids PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD
- Top Product
- Discover our top product DIRAS1 Primary Antibody
-
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (C-Term) antibody
DIRAS1 Reactivity: Human, Mouse WB, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (AA 109-136) antibodyDIRAS1 Reactivity: Human WB, FACS, IHC (p) Host: Rabbit Polyclonal RB23689 unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (AA 1-195) antibodyDIRAS1 Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (AA 115-145), (Middle Region) antibodyDIRAS1 Reactivity: Human WB, FACS, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (C-Term) antibodyDIRAS1 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (C-Term) antibodyDIRAS1 Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (C-Term) antibodyDIRAS1 Reactivity: Human WB, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (AA 58-87) antibodyDIRAS1 Reactivity: Human WB Host: Rabbit Polyclonal RB54547 unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (C-Term) antibodyDIRAS1 Reactivity: Human, Rat, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (N-Term) antibodyDIRAS1 Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Monkey, Bat, Chicken, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DIRAS1 Blocking Peptide, catalog no. 33R-7059, is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRAS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))
- Alternative Name
- DIRAS1 (DIRAS1 Products)
- Synonyms
- Di-Ras1 antibody, GBTS1 antibody, RIG antibody, Gbts1 antibody, diras1 antibody, fi18d11 antibody, wu:fi18d11 antibody, zgc:55360 antibody, si:dkey-97k23.2 antibody, rig antibody, gbts1 antibody, di-ras1 antibody, MGC146486 antibody, DIRAS family GTPase 1 antibody, DIRAS family, GTP-binding RAS-like 1 antibody, DIRAS family, GTP-binding RAS-like 1a antibody, DIRAS family, GTP-binding RAS-like 1b antibody, DIRAS family GTP binding RAS like 1 antibody, DIRAS1 antibody, Diras1 antibody, diras1a antibody, diras1b antibody, diras1 antibody
- Background
- DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-
