IFIT5 antibody (N-Term)
-
- Target See all IFIT5 products
- IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IFIT5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IFIT5 antibody was raised against the N terminal of IFIT5
- Purification
- Affinity purified
- Immunogen
- IFIT5 antibody was raised using the N terminal of IFIT5 corresponding to a region with amino acids LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IFIT5 Blocking Peptide, catalog no. 33R-4886, is also available for use as a blocking control in assays to test for specificity of this IFIT5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))
- Alternative Name
- IFIT5 (IFIT5 Products)
- Synonyms
- ri58 antibody, DKFZp469M2320 antibody, P58 antibody, RI58 antibody, interferon induced protein with tetratricopeptide repeats 5 antibody, interferon induced protein with tetratricopeptide repeats 5 L homeolog antibody, interferon-induced protein with tetratricopeptide repeats 5 antibody, IFIT5 antibody, ifit5.L antibody, LOC100024963 antibody, LOC100151816 antibody, ifit5 antibody
- Background
- IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.
- Molecular Weight
- 56 kDa (MW of target protein)
-