IFIT5 antibody (N-Term)

Catalog No. ABIN634392

Product Details anti-IFIT5 Antibody

Target: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFIT5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IFIT5 antibody was raised against the N terminal of IFIT5

Purification: Affinity purified

Immunogen: IFIT5 antibody was raised using the N terminal of IFIT5 corresponding to a region with amino acids LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFIT5 Blocking Peptide, catalog no. 33R-4886, is also available for use as a blocking control in assays to test for specificity of this IFIT5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFIT5

Target: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Alternative Name: IFIT5 (IFIT5 Products)

Synonyms: ri58 antibody, DKFZp469M2320 antibody, P58 antibody, RI58 antibody, interferon induced protein with tetratricopeptide repeats 5 antibody, interferon induced protein with tetratricopeptide repeats 5 L homeolog antibody, interferon-induced protein with tetratricopeptide repeats 5 antibody, IFIT5 antibody, ifit5.L antibody, LOC100024963 antibody, LOC100151816 antibody, ifit5 antibody

Background: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Molecular Weight: 56 kDa (MW of target protein)