RASGEF1C antibody (Middle Region)

Catalog No. ABIN634380

Product Details anti-RASGEF1C Antibody

Target: RASGEF1C (RasGEF Domain Family, Member 1C (RASGEF1C))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RASGEF1C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RASGEF1 C antibody was raised against the middle region of RASGEF1

Purification: Affinity purified

Immunogen: RASGEF1 C antibody was raised using the middle region of RASGEF1 corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RASGEF1C Blocking Peptide, catalog no. 33R-2957, is also available for use as a blocking control in assays to test for specificity of this RASGEF1C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGEF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RASGEF1C

Target: RASGEF1C (RasGEF Domain Family, Member 1C (RASGEF1C))

Alternative Name: RASGEF1C (RASGEF1C Products)

Synonyms: RASGEF1C antibody, 9130006A14Rik antibody, RasGEF domain family member 1C antibody, RasGEF domain family, member 1C antibody, RASGEF1C antibody, Rasgef1c antibody

Background: RASGEF1C is the guanine nucleotide exchange factor (GEF).

Molecular Weight: 53 kDa (MW of target protein)