RASGEF1C antibody (Middle Region)
-
- Target See all RASGEF1C Antibodies
- RASGEF1C (RasGEF Domain Family, Member 1C (RASGEF1C))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RASGEF1C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RASGEF1 C antibody was raised against the middle region of RASGEF1
- Purification
- Affinity purified
- Immunogen
- RASGEF1 C antibody was raised using the middle region of RASGEF1 corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE
- Top Product
- Discover our top product RASGEF1C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RASGEF1C Blocking Peptide, catalog no. 33R-2957, is also available for use as a blocking control in assays to test for specificity of this RASGEF1C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGEF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RASGEF1C (RasGEF Domain Family, Member 1C (RASGEF1C))
- Alternative Name
- RASGEF1C (RASGEF1C Products)
- Synonyms
- RASGEF1C antibody, 9130006A14Rik antibody, RasGEF domain family member 1C antibody, RasGEF domain family, member 1C antibody, RASGEF1C antibody, Rasgef1c antibody
- Background
- RASGEF1C is the guanine nucleotide exchange factor (GEF).
- Molecular Weight
- 53 kDa (MW of target protein)
-