RASGRP2 antibody

Catalog No. ABIN634377

Product Details anti-RASGRP2 Antibody

Target: RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RASGRP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RASGRP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RASGRP2 Blocking Peptide, catalog no. 33R-5537, is also available for use as a blocking control in assays to test for specificity of this RASGRP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RASGRP2

Target: RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))

Alternative Name: RASGRP2 (RASGRP2 Products)

Synonyms: CALDAG-GEFI antibody, CDC25L antibody, xrasgrp2 antibody, RASGRP2 antibody, Caldaggef1 antibody, CalDAG-GEFI antibody, rasgrp2 antibody, RAS guanyl releasing protein 2 antibody, RAS guanyl releasing protein 2 (calcium and DAG-regulated) S homeolog antibody, RAS, guanyl releasing protein 2 antibody, RAS guanyl releasing protein 2 (calcium and DAG-regulated) L homeolog antibody, RASGRP2 antibody, rasgrp2.S antibody, Rasgrp2 antibody, rasgrp2.L antibody

Background: The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain.

Molecular Weight: 69 kDa (MW of target protein)

Pathways: TCR Signaling