DOCK2 antibody (Middle Region)
-
- Target See all DOCK2 Antibodies
- DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DOCK2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DOCK2 antibody was raised against the middle region of DOCK2
- Purification
- Affinity purified
- Immunogen
- DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA
- Top Product
- Discover our top product DOCK2 Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DOCK2 Blocking Peptide, catalog no. 33R-1320, is also available for use as a blocking control in assays to test for specificity of this DOCK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOCK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))
- Alternative Name
- DOCK2 (DOCK2 Products)
- Synonyms
- AI662014 antibody, AW122239 antibody, CED-5 antibody, Hch antibody, MBC antibody, dedicator of cytokinesis 2 antibody, dedicator of cyto-kinesis 2 antibody, DOCK2 antibody, dock2 antibody, Dock2 antibody
- Background
- The DOCK2 gene encodes a hematopoietic cell-specific CDM family protein that is indispensable for lymphocyte chemotaxis.
- Molecular Weight
- 212 kDa (MW of target protein)
-