RRAD antibody (Middle Region)

Catalog No. ABIN634370

Product Details anti-RRAD Antibody

Target: RRAD (Ras-Related Associated with Diabetes (RRAD))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRAD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RRAD antibody was raised against the middle region of RRAD

Purification: Affinity purified

Immunogen: RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRAD Blocking Peptide, catalog no. 33R-4793, is also available for use as a blocking control in assays to test for specificity of this RRAD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRAD

Target: RRAD (Ras-Related Associated with Diabetes (RRAD))

Alternative Name: RRAD (RRAD Products)

Synonyms: ZGC:63471 antibody, RRAD antibody, RAD antibody, RAD1 antibody, REM3 antibody, Rad antibody, RRAD, Ras related glycolysis inhibitor and calcium channel regulator antibody, Ras-related associated with diabetes antibody, RRAD antibody, Rrad antibody

Background: RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents.

Molecular Weight: 33 kDa (MW of target protein)