ARL8A antibody (Middle Region)
-
- Target See all ARL8A Antibodies
- ARL8A (ADP-Ribosylation Factor-Like 8A (ARL8A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARL8A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARL8 A antibody was raised against the middle region of ARL8
- Purification
- Affinity purified
- Immunogen
- ARL8 A antibody was raised using the middle region of ARL8 corresponding to a region with amino acids IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ
- Top Product
- Discover our top product ARL8A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARL8A Blocking Peptide, catalog no. 33R-3970, is also available for use as a blocking control in assays to test for specificity of this ARL8A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARL8A (ADP-Ribosylation Factor-Like 8A (ARL8A))
- Alternative Name
- ARL8A (ARL8A Products)
- Synonyms
- gie2 antibody, MGC75773 antibody, fe25e11 antibody, si:ch1073-204j4.2 antibody, wu:fe25e11 antibody, PTPN7 antibody, ARL10B antibody, GIE2 antibody, 1110033P22Rik antibody, Arl10b antibody, RGD1565940 antibody, ADP ribosylation factor like GTPase 8A antibody, ARF-like GTPase antibody, ADP-ribosylation factor-like 8A antibody, ADP-ribosylation factor like GTPase 8A antibody, arl8a antibody, ARL8A antibody, ARL8a-2 antibody, ARL8a-1 antibody, Arl8a antibody
- Background
- ARL8A belongs to the small GTPase superfamily, Arf family. ARL8A m,ay play a role in lysosomes motility. Alternatively, may play a role in chromosomes segregation.
- Molecular Weight
- 21 kDa (MW of target protein)
-