MAP4K2 antibody (N-Term)

Catalog No. ABIN634356

Product Details anti-MAP4K2 Antibody

Target: MAP4K2 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP4K2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAP4 K2 antibody was raised against the N terminal of MAP4 2

Purification: Affinity purified

Immunogen: MAP4 K2 antibody was raised using the N terminal of MAP4 2 corresponding to a region with amino acids TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP4K2 Blocking Peptide, catalog no. 33R-9374, is also available for use as a blocking control in assays to test for specificity of this MAP4K2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP4K2

Target: MAP4K2 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2))

Alternative Name: MAP4K2 (MAP4K2 Products)

Synonyms: BL44 antibody, GCK antibody, RAB8IP antibody, AI385662 antibody, Rab8ip antibody, MAP4K2 antibody, dZ150L22.2 antibody, map4k2l antibody, map4k2l-2 antibody, map4k3l antibody, si:dz150l22.2 antibody, si:dz263j20.1 antibody, zgc:136670 antibody, mitogen-activated protein kinase kinase kinase kinase 2 antibody, mitogen activated protein kinase kinase kinase kinase 2 antibody, MAP4K2 antibody, Map4k2 antibody, LOC103346779 antibody, map4k2 antibody

Background: MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.

Molecular Weight: 91 kDa (MW of target protein)