MAP4K5 antibody (Middle Region)
-
- Target See all MAP4K5 Antibodies
- MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAP4K5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAP4 K5 antibody was raised against the middle region of MAP4 5
- Purification
- Affinity purified
- Immunogen
- MAP4 K5 antibody was raised using the middle region of MAP4 5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA
- Top Product
- Discover our top product MAP4K5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAP4K5 Blocking Peptide, catalog no. 33R-7562, is also available for use as a blocking control in assays to test for specificity of this MAP4K5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))
- Alternative Name
- MAP4K5 (MAP4K5 Products)
- Synonyms
- GCKR antibody, KHS antibody, KHS1 antibody, MAPKKKK5 antibody, 4432415E19Rik antibody, RGD1562028 antibody, fl74c10 antibody, wu:fl74c10 antibody, zgc:55719 antibody, zgc:55985 antibody, mitogen-activated protein kinase kinase kinase kinase 5 antibody, mitogen-activated protein kinase kinase kinase kinase 5 S homeolog antibody, MAP4K5 antibody, Map4k5 antibody, map4k5 antibody, map4k5.S antibody
- Background
- MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.
- Molecular Weight
- 95 kDa (MW of target protein)
-