TAB1 antibody (N-Term)
-
- Target See all TAB1 Antibodies
- TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TAB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAP3 K3 P1 antibody was raised against the N terminal of MAP3 3 P1
- Purification
- Affinity purified
- Immunogen
- MAP3 K3 P1 antibody was raised using the N terminal of MAP3 3 P1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE
- Top Product
- Discover our top product TAB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAP3K7IP1 Blocking Peptide, catalog no. 33R-5608, is also available for use as a blocking control in assays to test for specificity of this MAP3K7IP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 0 P1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))
- Alternative Name
- MAP3K7IP1 (TAB1 Products)
- Background
- The protein encoded by this gene was identified as a regulator of the MAP kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1.
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades
-