TAB1 antibody (N-Term)

Catalog No. ABIN634348

Product Details anti-TAB1 Antibody

Target: TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TAB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAP3 K3 P1 antibody was raised against the N terminal of MAP3 3 P1

Purification: Affinity purified

Immunogen: MAP3 K3 P1 antibody was raised using the N terminal of MAP3 3 P1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP3K7IP1 Blocking Peptide, catalog no. 33R-5608, is also available for use as a blocking control in assays to test for specificity of this MAP3K7IP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TAB1

Target: TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))

Alternative Name: MAP3K7IP1 (TAB1 Products)

Synonyms: 3'-Tab1 antibody, MAP3K7IP1 antibody, 2310012M03Rik antibody, Map3k7ip1 antibody, b2b449Clo antibody, TGF-beta activated kinase 1 (MAP3K7) binding protein 1 antibody, TGF-beta activated kinase 1/MAP3K7 binding protein 1 antibody, TAB1 antibody, Tab1 antibody

Background: The protein encoded by this gene was identified as a regulator of the MAP kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades