FES antibody (N-Term)

Catalog No. ABIN634347

Product Details anti-FES Antibody

Target: FES (Feline Sarcoma Oncogene (FES))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FES antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FES antibody was raised against the N terminal of FES

Purification: Affinity purified

Immunogen: FES antibody was raised using the N terminal of FES corresponding to a region with amino acids ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FES Blocking Peptide, catalog no. 33R-1466, is also available for use as a blocking control in assays to test for specificity of this FES antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FES

Target: FES (Feline Sarcoma Oncogene (FES))

Alternative Name: FES (FES Products)

Synonyms: FPS antibody, RGD1564385 antibody, AI586313 antibody, BB137047 antibody, c-fes antibody, FES antibody, c-fps antibody, FES proto-oncogene, tyrosine kinase antibody, feline sarcoma oncogene antibody, FES antibody, Fes antibody, fes antibody

Background: FES is the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. FES has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis.

Molecular Weight: 93 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Signaling Events mediated by VEGFR1 and VEGFR2