SH2D3C antibody (N-Term)

Catalog No. ABIN634344

Product Details anti-SH2D3C Antibody

Target: SH2D3C (SH2 Domain Containing 3C (SH2D3C))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH2D3C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SH2 D2 antibody was raised against the N terminal of SH2 2

Purification: Affinity purified

Immunogen: SH2 D2 antibody was raised using the N terminal of SH2 2 corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH2D3C Blocking Peptide, catalog no. 33R-1220, is also available for use as a blocking control in assays to test for specificity of this SH2D3C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH2D3C

Target: SH2D3C (SH2 Domain Containing 3C (SH2D3C))

Alternative Name: SH2D3C (SH2D3C Products)

Synonyms: sh2d3c antibody, zgc:56490 antibody, SH2D3C antibody, CHAT antibody, NSP3 antibody, PRO34088 antibody, SHEP1 antibody, Chat antibody, Nsp3 antibody, Shep1 antibody, SH2 domain containing 3Cb antibody, SH2 domain containing 3C antibody, SH2 domain-containing protein 3C antibody, SH2 domain containing 3C L homeolog antibody, sh2d3cb antibody, SH2D3C antibody, LOC100466471 antibody, sh2d3c antibody, sh2d3c.L antibody, Sh2d3c antibody

Background: SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.

Molecular Weight: 77 kDa (MW of target protein)