WNK3 antibody (N-Term)

Catalog No. ABIN634341

Product Details anti-WNK3 Antibody

Target: WNK3 (WNK Lysine Deficient Protein Kinase 3 (WNK3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNK3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WNK3 antibody was raised against the N terminal of WNK3

Purification: Affinity purified

Immunogen: WNK3 antibody was raised using the N terminal of WNK3 corresponding to a region with amino acids WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNK3 Blocking Peptide, catalog no. 33R-10032, is also available for use as a blocking control in assays to test for specificity of this WNK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNK3

Target: WNK3 (WNK Lysine Deficient Protein Kinase 3 (WNK3))

Alternative Name: WNK3 (WNK3 Products)

Synonyms: fc63h12 antibody, PRKWNK3 antibody, Prkwnk3 antibody, Wnk3-ps antibody, RGD1563131 antibody, wu:fc63h12 antibody, WNK lysine deficient protein kinase 3 antibody, wu:fc63h12 antibody, LOC100363278 antibody, WNK3 antibody, Wnk3 antibody

Background: Members of the 'with no lysine' (WNK) kinase family, such as WNK3, are serine-threonine protein kinases that lack the almost invariant catalytic lysine in subdomain II, which is important for binding ATP in the catalytic site.

Molecular Weight: 192 kDa (MW of target protein)