RHOD antibody (C-Term)

Catalog No. ABIN634339

Product Details anti-RHOD Antibody

Target: RHOD (Ras Homolog Family Member D (RHOD))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHOD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RHOD antibody was raised against the C terminal of RHOD

Purification: Affinity purified

Immunogen: RHOD antibody was raised using the C terminal of RHOD corresponding to a region with amino acids NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHOD Blocking Peptide, catalog no. 33R-6707, is also available for use as a blocking control in assays to test for specificity of this RHOD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHOD

Target: RHOD (Ras Homolog Family Member D (RHOD))

Alternative Name: RHOD (RHOD Products)

Synonyms: ARHD antibody, RHOHP1 antibody, RHOM antibody, Rho antibody, AI326383 antibody, Arhd antibody, RhoHP1 antibody, RhoM antibody, ras homolog family member D antibody, RHOD antibody, Rhod antibody

Background: Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation.

Molecular Weight: 23 kDa (MW of target protein)