SNX18 antibody (N-Term)

Catalog No. ABIN634337

Product Details anti-SNX18 Antibody

Target: SNX18 (Sorting Nexin 18 (SNX18))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNX18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNAG1 antibody was raised against the N terminal Of Snag1

Purification: Affinity purified

Immunogen: SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNAG1 Blocking Peptide, catalog no. 33R-5183, is also available for use as a blocking control in assays to test for specificity of this SNAG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNX18

Target: SNX18 (Sorting Nexin 18 (SNX18))

Alternative Name: SNAG1 (SNX18 Products)

Synonyms: snag1 antibody, MGC82637 antibody, SNX18 antibody, SNAG1 antibody, si:dkey-193c22.4 antibody, SH3PX2 antibody, SH3PXD3B antibody, Snag1 antibody, sorting nexin 18 L homeolog antibody, sorting nexin 18 antibody, sorting nexin 18 S homeolog antibody, sorting nexin 18a antibody, snx18.L antibody, SNX18 antibody, snx18.S antibody, snx18 antibody, snx18a antibody, Snx18 antibody

Background: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.

Molecular Weight: 69 kDa (MW of target protein)