SNX18 antibody (N-Term)
-
- Target See all SNX18 Antibodies
- SNX18 (Sorting Nexin 18 (SNX18))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNX18 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SNAG1 antibody was raised against the N terminal Of Snag1
- Purification
- Affinity purified
- Immunogen
- SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD
- Top Product
- Discover our top product SNX18 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNAG1 Blocking Peptide, catalog no. 33R-5183, is also available for use as a blocking control in assays to test for specificity of this SNAG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNX18 (Sorting Nexin 18 (SNX18))
- Alternative Name
- SNAG1 (SNX18 Products)
- Background
- This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.
- Molecular Weight
- 69 kDa (MW of target protein)
-