RHOC antibody (N-Term)
-
- Target See all RHOC Antibodies
- RHOC (Ras Homolog Gene Family, Member C (RHOC))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Drosophila melanogaster, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RHOC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RHOC antibody was raised against the N terminal of RHOC
- Purification
- Affinity purified
- Immunogen
- RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF
- Top Product
- Discover our top product RHOC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RHOC Blocking Peptide, catalog no. 33R-9740, is also available for use as a blocking control in assays to test for specificity of this RHOC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHOC (Ras Homolog Gene Family, Member C (RHOC))
- Alternative Name
- RHOC (RHOC Products)
- Background
- RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- WNT Signaling, Cell-Cell Junction Organization
-