UBD antibody (N-Term)

Catalog No. ABIN634317

Product Details anti-UBD Antibody

Target: UBD (Ubiquitin D (UBD))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ubiquitin D antibody was raised against the N terminal of UBD

Purification: Affinity purified

Immunogen: Ubiquitin D antibody was raised using the N terminal of UBD corresponding to a region with amino acids RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ubiquitin D Blocking Peptide, catalog no. 33R-8192, is also available for use as a blocking control in assays to test for specificity of this Ubiquitin D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBD

Target: UBD (Ubiquitin D (UBD))

Alternative Name: Ubiquitin D (UBD Products)

Synonyms: FAT10 antibody, GABBR1 antibody, UBD-3 antibody, ubiquitin D antibody, UBD antibody, Ubd antibody

Background: UBD qualifies as a marker for an interferon response in hepatocellular carcinoma and colon carcinoma but is not significantly overexpressed in cancers lacking a proinflammatory environment. Immunohistochemical studies demonstrated increased UBD expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway