UBD antibody (N-Term)
-
- Target See all UBD Antibodies
- UBD (Ubiquitin D (UBD))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Ubiquitin D antibody was raised against the N terminal of UBD
- Purification
- Affinity purified
- Immunogen
- Ubiquitin D antibody was raised using the N terminal of UBD corresponding to a region with amino acids RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE
- Top Product
- Discover our top product UBD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Ubiquitin D Blocking Peptide, catalog no. 33R-8192, is also available for use as a blocking control in assays to test for specificity of this Ubiquitin D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBD (Ubiquitin D (UBD))
- Alternative Name
- Ubiquitin D (UBD Products)
- Background
- UBD qualifies as a marker for an interferon response in hepatocellular carcinoma and colon carcinoma but is not significantly overexpressed in cancers lacking a proinflammatory environment. Immunohistochemical studies demonstrated increased UBD expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease.
- Molecular Weight
- 18 kDa (MW of target protein)
- Pathways
- Ubiquitin Proteasome Pathway
-