RASGEF1A antibody (N-Term)
-
- Target See all RASGEF1A Antibodies
- RASGEF1A (RasGEF Domain Family, Member 1A (RASGEF1A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RASGEF1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RASGEF1 A antibody was raised against the N terminal of RASGEF1
- Purification
- Affinity purified
- Immunogen
- RASGEF1 A antibody was raised using the N terminal of RASGEF1 corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL
- Top Product
- Discover our top product RASGEF1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RASGEF1A Blocking Peptide, catalog no. 33R-9069, is also available for use as a blocking control in assays to test for specificity of this RASGEF1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGEF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RASGEF1A (RasGEF Domain Family, Member 1A (RASGEF1A))
- Alternative Name
- RASGEF1A (RASGEF1A Products)
- Synonyms
- MGC84301 antibody, CG4853 antibody, 6330404M18Rik antibody, AI835194 antibody, RasGEF domain family member 1A antibody, RasGEF domain family member 1A L homeolog antibody, RasGEF domain family, member 1A antibody, RASGEF1A antibody, rasgef1a.L antibody, rasgef1a antibody, Rasgef1a antibody
- Background
- RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.
- Molecular Weight
- 54 kDa (MW of target protein)
-