RASGEF1A antibody (N-Term)

Catalog No. ABIN634311

Product Details anti-RASGEF1A Antibody

Target: RASGEF1A (RasGEF Domain Family, Member 1A (RASGEF1A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RASGEF1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RASGEF1 A antibody was raised against the N terminal of RASGEF1

Purification: Affinity purified

Immunogen: RASGEF1 A antibody was raised using the N terminal of RASGEF1 corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RASGEF1A Blocking Peptide, catalog no. 33R-9069, is also available for use as a blocking control in assays to test for specificity of this RASGEF1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGEF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RASGEF1A

Target: RASGEF1A (RasGEF Domain Family, Member 1A (RASGEF1A))

Alternative Name: RASGEF1A (RASGEF1A Products)

Synonyms: MGC84301 antibody, CG4853 antibody, 6330404M18Rik antibody, AI835194 antibody, RasGEF domain family member 1A antibody, RasGEF domain family member 1A L homeolog antibody, RasGEF domain family, member 1A antibody, RASGEF1A antibody, rasgef1a.L antibody, rasgef1a antibody, Rasgef1a antibody

Background: RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.

Molecular Weight: 54 kDa (MW of target protein)