GRF2 antibody

Catalog No. ABIN634290

Product Details anti-GRF2 Antibody

Target: GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRF2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAPGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAPGEF1 Blocking Peptide, catalog no. 33R-5553, is also available for use as a blocking control in assays to test for specificity of this RAPGEF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRF2

Target: GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))

Alternative Name: RAPGEF1 (RAPGEF1 Products)

Synonyms: C3G antibody, GRF2 antibody, Link-GEFII antibody, 4932418O06Rik antibody, Grf2 antibody, RAPGEF1 antibody, C3G-1 antibody, C3G-2 antibody, C3g antibody, rapgef1 antibody, zgc:56372 antibody, Rap guanine nucleotide exchange factor 1 antibody, Rap guanine nucleotide exchange factor like 1 antibody, Rap guanine nucleotide exchange factor (GEF) 1 antibody, Rap guanine nucleotide exchange factor 1 S homeolog antibody, Rap guanine nucleotide exchange factor (GEF) 1b antibody, RAPGEF1 antibody, RAPGEFL1 antibody, Rapgef1 antibody, rapgef1.S antibody, rapgef1 antibody, rapgef1b antibody, Rapgefl1 antibody

Background: RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.

Molecular Weight: 120 kDa (MW of target protein)

Pathways: Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Platelet-derived growth Factor Receptor Signaling, Signaling of Hepatocyte Growth Factor Receptor