GRF2 antibody
-
- Target See all GRF2 (RAPGEF1) Antibodies
- GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GRF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RAPGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK
- Top Product
- Discover our top product RAPGEF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAPGEF1 Blocking Peptide, catalog no. 33R-5553, is also available for use as a blocking control in assays to test for specificity of this RAPGEF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRF2 (RAPGEF1) (Rap Guanine Nucleotide Exchange Factor (GEF) 1 (RAPGEF1))
- Alternative Name
- RAPGEF1 (RAPGEF1 Products)
- Background
- RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.
- Molecular Weight
- 120 kDa (MW of target protein)
- Pathways
- Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Platelet-derived growth Factor Receptor Signaling, Signaling of Hepatocyte Growth Factor Receptor
-