ARL5A antibody (Middle Region)

Catalog No. ABIN634288

Product Details anti-ARL5A Antibody

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARL5A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARL5 A antibody was raised against the middle region of ARL5

Purification: Affinity purified

Immunogen: ARL5 A antibody was raised using the middle region of ARL5 corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL5A Blocking Peptide, catalog no. 33R-10153, is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARL5A

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Alternative Name: ARL5A (ARL5A Products)

Background: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Molecular Weight: 20 kDa (MW of target protein)