ARL5A antibody (Middle Region)

Catalog No. ABIN634288

Product Details anti-ARL5A Antibody

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARL5A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARL5 A antibody was raised against the middle region of ARL5

Purification: Affinity purified

Immunogen: ARL5 A antibody was raised using the middle region of ARL5 corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL5A Blocking Peptide, catalog no. 33R-10153, is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARL5A

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Alternative Name: ARL5A (ARL5A Products)

Synonyms: arl8 antibody, MGC89392 antibody, ARL5A antibody, arl5a antibody, zgc:92193 antibody, ARFLP5 antibody, ARL5 antibody, 2410015N24Rik antibody, 2810410P22Rik antibody, AA408731 antibody, AW610751 antibody, Arl5 antibody, T25534 antibody, ADP ribosylation factor like GTPase 5B antibody, ADP ribosylation factor like GTPase 5A antibody, ADP-ribosylation factor-like 5A antibody, ADP ribosylation factor like GTPase 5B S homeolog antibody, ADP-ribosylation factor like GTPase 5A antibody, ADP-ribosylation factor-like protein 5 antibody, arl5b antibody, ARL5A antibody, arl5a antibody, arl5b.S antibody, Arl5a antibody, arl-5 antibody

Background: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Molecular Weight: 20 kDa (MW of target protein)