DUSP8 antibody (Middle Region)

Catalog No. ABIN634286

Product Details anti-DUSP8 Antibody

Target: DUSP8 (Dual Specificity Phosphatase 8 (DUSP8))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DUSP8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DUSP8 antibody was raised against the middle region of DUSP8

Purification: Affinity purified

Immunogen: DUSP8 antibody was raised using the middle region of DUSP8 corresponding to a region with amino acids PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DUSP8 Blocking Peptide, catalog no. 33R-6973, is also available for use as a blocking control in assays to test for specificity of this DUSP8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DUSP8

Target: DUSP8 (Dual Specificity Phosphatase 8 (DUSP8))

Alternative Name: DUSP8 (DUSP8 Products)

Synonyms: zgc:77593 antibody, C11orf81 antibody, HB5 antibody, HVH-5 antibody, HVH8 antibody, 5530400B01Rik antibody, AI593498 antibody, Nttp1 antibody, Hb5 antibody, M3/6 antibody, DUSP8 antibody, dual specificity phosphatase 8 antibody, dual specificity phosphatase 8a antibody, dual specificity protein phosphatase 8 antibody, DUSP8 antibody, dusp8 antibody, dusp8a antibody, DSP8 antibody, Dusp8 antibody, LOC615727 antibody

Background: DUSP8 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli.

Molecular Weight: 66 kDa (MW of target protein)