RFT1 antibody
-
- Target See all RFT1 Antibodies
- RFT1 (RFT1 Homolog (RFT1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RFT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV
- Top Product
- Discover our top product RFT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RFT1 Blocking Peptide, catalog no. 33R-3615, is also available for use as a blocking control in assays to test for specificity of this RFT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RFT1 (RFT1 Homolog (RFT1))
- Alternative Name
- RFT1 (RFT1 Products)
- Synonyms
- GB14370 antibody, CDG1N antibody, D930025H04 antibody, RGD1562654 antibody, protein RFT1 homolog antibody, RFT1 homolog antibody, LOC412489 antibody, LOC100453537 antibody, RFT1 antibody, rft1 antibody, LOC100633251 antibody, LOC100651701 antibody, Rft1 antibody
- Background
- N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of aMan(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.
- Molecular Weight
- 60 kDa (MW of target protein)
-