FICD antibody (C-Term)

Catalog No. ABIN634275

Product Details anti-FICD Antibody

Target: FICD (FIC Domain Containing (FICD))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FICD antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: FICD antibody was raised against the C terminal of FICD

Purification: Affinity purified

Immunogen: FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FICD Blocking Peptide, catalog no. 33R-3215, is also available for use as a blocking control in assays to test for specificity of this FICD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FICD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FICD

Target: FICD (FIC Domain Containing (FICD))

Alternative Name: FICD (FICD Products)

Synonyms: HIP13 antibody, HYPE antibody, UNQ3041 antibody, D5Ertd40e antibody, Hype antibody, FIC domain containing antibody, FICD antibody, Ficd antibody

Background: FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.

Molecular Weight: 52 kDa (MW of target protein)