TGFB3 antibody (Middle Region)
-
- Target See all TGFB3 Antibodies
- TGFB3 (Transforming Growth Factor, beta 3 (TGFB3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TGFB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TGF beta 3 antibody was raised against the middle region of TGFB3
- Purification
- Affinity purified
- Immunogen
- TGF beta 3 antibody was raised using the middle region of TGFB3 corresponding to a region with amino acids DFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEA
- Top Product
- Discover our top product TGFB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TGF beta 3 Blocking Peptide, catalog no. 33R-1938, is also available for use as a blocking control in assays to test for specificity of this TGF beta 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TGFB3 (Transforming Growth Factor, beta 3 (TGFB3))
- Alternative Name
- TGF beta 3 (TGFB3 Products)
- Synonyms
- TGFB3 antibody, ARVD antibody, TGF-beta3 antibody, Tgfb-3 antibody, TGF-B3 antibody, TGFbeta3 antibody, wu:fc78g09 antibody, zgc:92058 antibody, transforming growth factor beta 3 antibody, transforming growth factor, beta 3 antibody, TGFB3 antibody, Tgfb3 antibody, tgfb3 antibody
- Background
- TGFB3 is involved in embryogenesis and cell differentiation.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus
-