JAG2 antibody (N-Term)
-
- Target See all JAG2 Antibodies
- JAG2 (Jagged 2 (JAG2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This JAG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Jagged 2 antibody was raised against the N terminal of JAG2
- Purification
- Affinity purified
- Immunogen
- Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
- Top Product
- Discover our top product JAG2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Jagged 2 Blocking Peptide, catalog no. 33R-7820, is also available for use as a blocking control in assays to test for specificity of this Jagged 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- JAG2 (Jagged 2 (JAG2))
- Alternative Name
- Jagged 2 (JAG2 Products)
- Background
- The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions.
- Molecular Weight
- 130 kDa (MW of target protein)
- Pathways
- Notch Signaling, Sensory Perception of Sound
-