LZTS2 antibody (N-Term)
-
- Target See all LZTS2 Antibodies
- LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LZTS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LZTS2 antibody was raised against the N terminal of LZTS2
- Purification
- Affinity purified
- Immunogen
- LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL
- Top Product
- Discover our top product LZTS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LZTS2 Blocking Peptide, catalog no. 33R-2636, is also available for use as a blocking control in assays to test for specificity of this LZTS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))
- Alternative Name
- LZTS2 (LZTS2 Products)
- Synonyms
- lapser1 antibody, MGC89253 antibody, si:dkey-250a11.1 antibody, LAPSER1 antibody, BC014695 antibody, mKIAA1813 antibody, Lapser1 antibody, leucine zipper, putative tumor suppressor 2 antibody, leucine zipper tumor suppressor 2 antibody, leucine zipper, putative tumor suppressor 2a antibody, leucine zipper, putative tumor suppressor 2 S homeolog antibody, lzts2 antibody, LZTS2 antibody, lzts2a antibody, Lzts2 antibody, lzts2.S antibody
- Background
- LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.
- Molecular Weight
- 73 kDa (MW of target protein)
-