Presenilin 2 antibody
-
- Target See all Presenilin 2 (PSEN2) Antibodies
- Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Presenilin 2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- Presenilin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
- Top Product
- Discover our top product PSEN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Presenilin 2 Blocking Peptide, catalog no. 33R-9902, is also available for use as a blocking control in assays to test for specificity of this Presenilin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSEN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))
- Alternative Name
- Presenilin 2 (PSEN2 Products)
- Background
- Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Notch Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway
-