Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Estrogen Receptor alpha antibody (Middle Region)

ESR1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634254
  • Target See all Estrogen Receptor alpha (ESR1) Antibodies
    Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))
    Binding Specificity
    • 30
    • 30
    • 28
    • 26
    • 22
    • 21
    • 21
    • 16
    • 16
    • 16
    • 16
    • 15
    • 15
    • 15
    • 13
    • 12
    • 11
    • 10
    • 9
    • 9
    • 8
    • 7
    • 7
    • 7
    • 6
    • 6
    • 6
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Middle Region
    Reactivity
    • 475
    • 171
    • 165
    • 18
    • 18
    • 10
    • 7
    • 7
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 1
    • 1
    Human
    Host
    • 386
    • 96
    • 2
    • 1
    Rabbit
    Clonality
    • 373
    • 114
    Polyclonal
    Conjugate
    • 212
    • 35
    • 22
    • 22
    • 18
    • 10
    • 9
    • 9
    • 9
    • 9
    • 9
    • 9
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 1
    • 1
    This Estrogen Receptor alpha antibody is un-conjugated
    Application
    • 355
    • 166
    • 140
    • 117
    • 94
    • 87
    • 80
    • 53
    • 32
    • 28
    • 23
    • 15
    • 8
    • 7
    • 7
    • 5
    • 5
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    Estrogen Receptor 1 antibody was raised against the middle region of ESR1
    Purification
    Affinity purified
    Immunogen
    Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE
    Top Product
    Discover our top product ESR1 Primary Antibody
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    Estrogen Receptor 1 Blocking Peptide, catalog no. 33R-5132, is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESR1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))
    Alternative Name
    Estrogen Receptor 1 (ESR1 Products)
    Synonyms
    LOC398734 antibody, AA420328 antibody, AU041214 antibody, ER-alpha antibody, ER[a] antibody, ERa antibody, ERalpha antibody, ESR antibody, Estr antibody, Estra antibody, Nr3a1 antibody, NR3A1 antibody, eralpha antibody, zfER[a] antibody, ER antibody, ESRA antibody, ESTRR antibody, Era antibody, akap12 antibody, cb27 antibody, esr1 antibody, fb72g12 antibody, id:ibd1202 antibody, sb:cb27 antibody, si:ch73-192g21.1 antibody, wu:fb72g12 antibody, wu:fc21c03 antibody, Esr antibody, RNESTROR antibody, ERALPHA antibody, er antibody, esr antibody, nr3a1 antibody, XER antibody, era antibody, esra antibody, ERbeta antibody, xesr-1 antibody, xlERalpha1 antibody, xlERalpha2 antibody, ESR1 antibody, estrogen receptor 1 L homeolog antibody, estrogen receptor 1 (alpha) antibody, estrogen receptor 1 antibody, A kinase (PRKA) anchor protein 12b antibody, esr1.L antibody, Esr1 antibody, ESR1 antibody, esr1 antibody, akap12b antibody
    Background
    Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.
    Molecular Weight
    66 kDa (MW of target protein)
    Pathways
    Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
You are here:
Support