Estrogen Receptor alpha antibody (Middle Region)

Catalog No. ABIN634254

Product Details anti-Estrogen Receptor alpha Antibody

Target: Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Estrogen Receptor alpha antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Estrogen Receptor 1 antibody was raised against the middle region of ESR1

Purification: Affinity purified

Immunogen: Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Estrogen Receptor 1 Blocking Peptide, catalog no. 33R-5132, is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Estrogen Receptor alpha

Target: Estrogen Receptor alpha (ESR1) (Estrogen Receptor 1 (ESR1))

Alternative Name: Estrogen Receptor 1 (ESR1 Products)

Synonyms: LOC398734 antibody, AA420328 antibody, AU041214 antibody, ER-alpha antibody, ER[a] antibody, ERa antibody, ERalpha antibody, ESR antibody, Estr antibody, Estra antibody, Nr3a1 antibody, NR3A1 antibody, eralpha antibody, zfER[a] antibody, ER antibody, ESRA antibody, ESTRR antibody, Era antibody, akap12 antibody, cb27 antibody, esr1 antibody, fb72g12 antibody, id:ibd1202 antibody, sb:cb27 antibody, si:ch73-192g21.1 antibody, wu:fb72g12 antibody, wu:fc21c03 antibody, Esr antibody, RNESTROR antibody, ERALPHA antibody, er antibody, esr antibody, nr3a1 antibody, XER antibody, era antibody, esra antibody, ERbeta antibody, xesr-1 antibody, xlERalpha1 antibody, xlERalpha2 antibody, ESR1 antibody, estrogen receptor 1 L homeolog antibody, estrogen receptor 1 (alpha) antibody, estrogen receptor 1 antibody, A kinase (PRKA) anchor protein 12b antibody, esr1.L antibody, Esr1 antibody, ESR1 antibody, esr1 antibody, akap12b antibody

Background: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, EGFR Signaling Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly