RBM14 antibody (N-Term)

Catalog No. ABIN634248

Product Details anti-RBM14 Antibody

Target: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM14 antibody was raised against the N terminal of RBM14

Purification: Affinity purified

Immunogen: RBM14 antibody was raised using the N terminal of RBM14 corresponding to a region with amino acids YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM14 Blocking Peptide, catalog no. 33R-10047, is also available for use as a blocking control in assays to test for specificity of this RBM14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM14

Target: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Alternative Name: RBM14 (RBM14 Products)

Background: RBM14 contains 2 RRM (RNA recognition motif) domains. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

Molecular Weight: 69 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway