KHDRBS1 antibody (N-Term)

Catalog No. ABIN634247

Product Details anti-KHDRBS1 Antibody

Target: KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KHDRBS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KHDRBS1 antibody was raised against the N terminal of KHDRBS1

Purification: Affinity purified

Immunogen: KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHDRBS1 Blocking Peptide, catalog no. 33R-5263, is also available for use as a blocking control in assays to test for specificity of this KHDRBS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KHDRBS1

Target: KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))

Alternative Name: KHDRBS1 (KHDRBS1 Products)

Synonyms: Sam68 antibody, p62 antibody, p68 antibody, fj90g10 antibody, khdrbs1 antibody, wu:fa18g12 antibody, wu:fa56c01 antibody, wu:fc91b01 antibody, wu:fj90g10 antibody, zgc:113899 antibody, KHDRBS1 antibody, P62 antibody, khdrbs1l antibody, sb:cb97 antibody, wu:fb07d11 antibody, wu:fi43c05 antibody, zgc:85948 antibody, KH RNA binding domain containing, signal transduction associated 1 antibody, KH domain containing, RNA binding, signal transduction associated 1a antibody, KH domain containing, RNA binding, signal transduction associated 1 antibody, KH domain containing, RNA binding, signal transduction associated 1 S homeolog antibody, KH domain containing, RNA binding, signal transduction associated 1b antibody, KHDRBS1 antibody, khdrbs1a antibody, khdrbs1 antibody, Khdrbs1 antibody, khdrbs1.S antibody, khdrbs1b antibody

Background: KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, Neurotrophin Signaling Pathway, Autophagy