PP5 antibody (N-Term)

Catalog No. ABIN634245

Product Details anti-PP5 Antibody

Target: PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PP5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PPP5 C antibody was raised against the N terminal of PPP5

Purification: Affinity purified

Immunogen: PPP5 C antibody was raised using the N terminal of PPP5 corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP5C Blocking Peptide, catalog no. 33R-5701, is also available for use as a blocking control in assays to test for specificity of this PPP5C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PP5

Target: PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))

Alternative Name: PPP5C (PPP5C Products)

Synonyms: PP5 antibody, PPP5 antibody, PPT antibody, AU020526 antibody, pp5 antibody, MGC89961 antibody, fc83f08 antibody, im:7146608 antibody, wu:fc83f08 antibody, zgc:110801 antibody, PPP5C antibody, protein phosphatase 5 catalytic subunit antibody, protein phosphatase 5, catalytic subunit antibody, protein phosphatase 5, catalytic subunit S homeolog antibody, serine/threonine-protein phosphatase 5 antibody, PPP5C antibody, Ppp5c antibody, ppp5c.S antibody, ppp5c antibody, LOC592155 antibody, LOC100513542 antibody, LOC100564151 antibody, LOC100186268 antibody, LOC100208775 antibody

Background: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Molecular Weight: 57 kDa (MW of target protein)