PP5 antibody (N-Term)
-
- Target See all PP5 (PPP5C) Antibodies
- PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PP5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPP5 C antibody was raised against the N terminal of PPP5
- Purification
- Affinity purified
- Immunogen
- PPP5 C antibody was raised using the N terminal of PPP5 corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF
- Top Product
- Discover our top product PPP5C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP5C Blocking Peptide, catalog no. 33R-5701, is also available for use as a blocking control in assays to test for specificity of this PPP5C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))
- Alternative Name
- PPP5C (PPP5C Products)
- Synonyms
- PP5 antibody, PPP5 antibody, PPT antibody, AU020526 antibody, pp5 antibody, MGC89961 antibody, fc83f08 antibody, im:7146608 antibody, wu:fc83f08 antibody, zgc:110801 antibody, PPP5C antibody, protein phosphatase 5 catalytic subunit antibody, protein phosphatase 5, catalytic subunit antibody, protein phosphatase 5, catalytic subunit S homeolog antibody, serine/threonine-protein phosphatase 5 antibody, PPP5C antibody, Ppp5c antibody, ppp5c.S antibody, ppp5c antibody, LOC592155 antibody, LOC100513542 antibody, LOC100564151 antibody, LOC100186268 antibody, LOC100208775 antibody
- Background
- PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.
- Molecular Weight
- 57 kDa (MW of target protein)
-