TdT antibody (Middle Region)
-
- Target See all TdT (DNTT) Antibodies
- TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TdT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DNTT antibody was raised against the middle region of DNTT
- Purification
- Affinity purified
- Immunogen
- DNTT antibody was raised using the middle region of DNTT corresponding to a region with amino acids LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN
- Top Product
- Discover our top product DNTT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNTT Blocking Peptide, catalog no. 33R-5388, is also available for use as a blocking control in assays to test for specificity of this DNTT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNTT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))
- Alternative Name
- DNTT (DNTT Products)
- Synonyms
- TdT antibody, TDT antibody, BB160593 antibody, Tdt antibody, dntt-A antibody, dntt antibody, DNA nucleotidylexotransferase antibody, deoxynucleotidyltransferase, terminal antibody, DNA nucleotidylexotransferase L homeolog antibody, terminal deoxynucleotidyl transferase antibody, DNTT antibody, dntt antibody, Dntt antibody, dntt.L antibody, tdt antibody
- Background
- DNTT is the template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor geneegments during the maturation of B- and T-cells.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-