TLK1 antibody (N-Term)

Catalog No. ABIN634240

Product Details anti-TLK1 Antibody

Target: TLK1 (Tousled-Like Kinase 1 (TLK1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TLK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TLK1 antibody was raised against the N terminal of TLK1

Purification: Affinity purified

Immunogen: TLK1 antibody was raised using the N terminal of TLK1 corresponding to a region with amino acids ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TLK1 Blocking Peptide, catalog no. 33R-2724, is also available for use as a blocking control in assays to test for specificity of this TLK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TLK1

Target: TLK1 (Tousled-Like Kinase 1 (TLK1))

Alternative Name: TLK1 (TLK1 Products)

Synonyms: PKU-beta antibody, 4930545J15Rik antibody, fe11e12 antibody, si:dkey-251e16.4 antibody, tlk1 antibody, wu:fe11e12 antibody, TLK1 antibody, fb76h12 antibody, si:dkey-88m1.1 antibody, wu:fb76h12 antibody, DKFZp459L163 antibody, tousled like kinase 1 antibody, tousled-like kinase 1 antibody, tousled-like kinase 1b antibody, tousled like kinase 1 like antibody, serine/threonine-protein kinase TOUSLED antibody, tousled-like kinase 1a antibody, Serine/threonine-protein kinase tousled-like 1 antibody, TLK1 antibody, Tlk1 antibody, tlk1b antibody, TLK1L antibody, LOC542181 antibody, tlk1a antibody, tlk1 antibody, tlk-1 antibody

Background: The Tousled-like kinases, first described in Arabadopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.

Molecular Weight: 84 kDa (MW of target protein)