NDN antibody
-
- Target See all NDN Antibodies
- NDN (Necdin Homolog (Mouse) (NDN))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NDN antibody was raised using a synthetic peptide corresponding to a region with amino acids VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF
- Top Product
- Discover our top product NDN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDN Blocking Peptide, catalog no. 33R-9426, is also available for use as a blocking control in assays to test for specificity of this NDN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDN (Necdin Homolog (Mouse) (NDN))
- Alternative Name
- NDN (NDN Products)
- Synonyms
- LOC574323 antibody, AI528698 antibody, Peg6 antibody, NDN antibody, HsT16328 antibody, PWCR antibody, necdin, MAGE family member antibody, necdin antibody, NDN antibody, Ndn antibody
- Background
- This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway
-