RNASEH2A antibody (C-Term)
-
- Target See all RNASEH2A Antibodies
- RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNASEH2A antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- RNASEH2 A antibody was raised against the C terminal of RNASEH2
- Purification
- Affinity purified
- Immunogen
- RNASEH2 A antibody was raised using the C terminal of RNASEH2 corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES
- Top Product
- Discover our top product RNASEH2A Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNASEH2A Blocking Peptide, catalog no. 33R-2500, is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))
- Alternative Name
- RNASEH2A (RNASEH2A Products)
- Synonyms
- 2400006P09Rik antibody, RNASEHI antibody, RNHIA antibody, RNHL antibody, zgc:56307 antibody, AGS4 antibody, JUNB antibody, ribonuclease H2 subunit A antibody, ribonuclease H2, large subunit antibody, ribonuclease H2, subunit A antibody, ribonuclease H2 subunit A L homeolog antibody, rnaseh2a antibody, RNASEH2A antibody, Rnaseh2a antibody, rnaseh2a.L antibody
- Background
- Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.
- Molecular Weight
- 33 kDa (MW of target protein)
-