DKC1 antibody (N-Term)

Catalog No. ABIN634217

Product Details anti-DKC1 Antibody

Target: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DKC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DKC1 antibody was raised against the N terminal of DKC1

Purification: Affinity purified

Immunogen: DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DKC1 Blocking Peptide, catalog no. 33R-2407, is also available for use as a blocking control in assays to test for specificity of this DKC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DKC1

Target: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Alternative Name: DKC1 (DKC1 Products)

Synonyms: CBF5 antibody, DKC antibody, DKCX antibody, NAP57 antibody, NOLA4 antibody, XAP101 antibody, dyskerin antibody, fv62a07 antibody, wu:fa28f10 antibody, wu:fc87a02 antibody, wu:fi24a05 antibody, wu:fv62a07 antibody, zgc:110395 antibody, DKC1 antibody, cbf5 antibody, dkc antibody, nap57 antibody, nola4 antibody, xap101 antibody, BC068171 antibody, Nap57 antibody, AtCBF5 antibody, AtNAP57 antibody, homologue of NAP57 antibody, dyskerin pseudouridine synthase 1 antibody, microRNA 664b antibody, dyskeratosis congenita 1, dyskerin antibody, dyskeratosis congenita 1, dyskerin L homeolog antibody, homologue of NAP57 antibody, DKC1 antibody, MIR664B antibody, dkc1 antibody, dkc1.L antibody, Dkc1 antibody, NAP57 antibody

Background: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Telomere Maintenance