TUBE1 antibody (Middle Region)

Catalog No. ABIN634213

Product Details anti-TUBE1 Antibody

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1

Purification: Affinity purified

Immunogen: Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Epsilon Tubulin 1 Blocking Peptide, catalog no. 33R-3777, is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBE1

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Alternative Name: epsilon Tubulin 1 (TUBE1 Products)

Synonyms: zgc:63582 antibody, LOC398412 antibody, TUBE1 antibody, tube antibody, 2310061K05Rik antibody, AI551343 antibody, Tube antibody, TUBE antibody, dJ142L7.2 antibody, tubulin, epsilon 1 antibody, tubulin epsilon 1 L homeolog antibody, tubulin epsilon 1 antibody, epsilon tubulin antibody, putative epsilon tubulin antibody, Epsilon tubulin antibody, tubulin epsilon chain antibody, epsilon-tubulin 1 antibody, tube1 antibody, tube1.L antibody, TUBE1 antibody, Tc00.1047053509967.160 antibody, Tc00.1047053509695.120 antibody, Tb10.70.6950 antibody, LMJF_21_1010 antibody, GL50803_6336 antibody, TUE antibody, tubE antibody, LOC100541905 antibody, Tube1 antibody

Background: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Microtubule Dynamics