TUBE1 antibody (Middle Region)
-
- Target See all TUBE1 Antibodies
- TUBE1 (Tubulin, epsilon 1 (TUBE1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TUBE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1
- Purification
- Affinity purified
- Immunogen
- Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA
- Top Product
- Discover our top product TUBE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Epsilon Tubulin 1 Blocking Peptide, catalog no. 33R-3777, is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TUBE1 (Tubulin, epsilon 1 (TUBE1))
- Alternative Name
- epsilon Tubulin 1 (TUBE1 Products)
- Background
- This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics
-