MOS antibody (Middle Region)
-
- Target See all MOS Antibodies
- MOS (Moloney Sarcoma Oncogene (MOS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MOS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MOS antibody was raised against the middle region of MOS
- Purification
- Affinity purified
- Immunogen
- MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
- Top Product
- Discover our top product MOS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MOS Blocking Peptide, catalog no. 33R-5250, is also available for use as a blocking control in assays to test for specificity of this MOS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MOS (Moloney Sarcoma Oncogene (MOS))
- Alternative Name
- MOS (MOS Products)
- Synonyms
- MOS antibody, c-mos antibody, msv antibody, p39 antibody, mosxe antibody, MSV antibody, p39-mos antibody, MOS proto-oncogene, serine/threonine kinase antibody, v-mos Moloney murine sarcoma viral oncogene homolog antibody, serine/threonine-protein kinase mos-like antibody, Moloney sarcoma oncogene antibody, MOS proto-oncogene, serine/threonine kinase L homeolog antibody, MOS antibody, mos antibody, LOC100229612 antibody, Mos antibody, mos.L antibody
- Background
- MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator.
- Molecular Weight
- 38 kDa (MW of target protein)
-