ANAPC10 antibody (N-Term)

Catalog No. ABIN634189

Product Details anti-ANAPC10 Antibody

Target: ANAPC10 (Anaphase Promoting Complex Subunit 10 (ANAPC10))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANAPC10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ANAPC10 antibody was raised against the N terminal of ANAPC10

Purification: Affinity purified

Immunogen: ANAPC10 antibody was raised using the N terminal of ANAPC10 corresponding to a region with amino acids MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANAPC10 Blocking Peptide, catalog no. 33R-6569, is also available for use as a blocking control in assays to test for specificity of this ANAPC10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANAPC10

Target: ANAPC10 (Anaphase Promoting Complex Subunit 10 (ANAPC10))

Alternative Name: ANAPC10 (ANAPC10 Products)

Background: ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: M Phase