Retinoblastoma Binding Protein 4 antibody (N-Term)

Catalog No. ABIN634184

Product Details anti-Retinoblastoma Binding Protein 4 Antibody

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Retinoblastoma Binding Protein 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBBP4 antibody was raised against the N terminal of RBBP4

Purification: Affinity purified

Immunogen: RBBP4 antibody was raised using the N terminal of RBBP4 corresponding to a region with amino acids HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBBP4 Blocking Peptide, catalog no. 33R-3865, is also available for use as a blocking control in assays to test for specificity of this RBBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Retinoblastoma Binding Protein 4

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Alternative Name: RBBP4 (RBBP4 Products)

Synonyms: NURF55 antibody, RBAP48 antibody, 154659_at antibody, 55 antibody, CAF-1 antibody, CAF1 antibody, CAF1-55 antibody, CAF1p55 antibody, CG4236 antibody, Caf-1 antibody, Caf1/p55 antibody, Caf1p55 antibody, Dmel\\CG4236 antibody, MSI1/RbAp48/CAC3/LIN-53 antibody, NURF antibody, NURF-55 antibody, Nurf antibody, Nurf 55 antibody, Nurf-55 antibody, Nurf55 antibody, P55 antibody, RbAp48 antibody, S(ls)3 antibody, caf-1 antibody, caf1 antibody, caf1 p55 antibody, d-CAF1 antibody, dCAF-1 antibody, dCAF-1 p55 antibody, dNURF antibody, p55 antibody, p55 CAF1 antibody, p55/NURF-55 antibody, p55CAF1 antibody, nurf55 antibody, rbap48 antibody, xrbbp4 antibody, mRbAp48 antibody, RBBP4 antibody, rbb4-2 antibody, zgc:55349 antibody, zgc:77854 antibody, wu:fb33a09 antibody, wu:fb40e10 antibody, RBBP-4 antibody, rbbp4 antibody, M4E13.110 antibody, M4E13_110 antibody, MULTICOPY SUPPRESSOR OF IRA1 3 antibody, NFC3 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP C 3 antibody, RB binding protein 4, chromatin remodeling factor antibody, Chromatin assembly factor 1, p55 subunit antibody, retinoblastoma binding protein 4 antibody, retinoblastoma binding protein 4, chromatin remodeling factor antibody, retinoblastoma binding protein 4 L homeolog antibody, Transducin family protein / WD-40 repeat family protein antibody, retinoblastoma binding protein 4 S homeolog antibody, RBBP4 antibody, Caf1-55 antibody, rbbp4 antibody, Rbbp4 antibody, rbbp4.L antibody, MSI3 antibody, rbbp4.S antibody

Background: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Cell Division Cycle, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus