Retinoblastoma Binding Protein 4 antibody (N-Term)
-
- Target See all Retinoblastoma Binding Protein 4 (RBBP4) Antibodies
- Retinoblastoma Binding Protein 4 (RBBP4)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Retinoblastoma Binding Protein 4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBBP4 antibody was raised against the N terminal of RBBP4
- Purification
- Affinity purified
- Immunogen
- RBBP4 antibody was raised using the N terminal of RBBP4 corresponding to a region with amino acids HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
- Top Product
- Discover our top product RBBP4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBBP4 Blocking Peptide, catalog no. 33R-3865, is also available for use as a blocking control in assays to test for specificity of this RBBP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoblastoma Binding Protein 4 (RBBP4)
- Alternative Name
- RBBP4 (RBBP4 Products)
- Background
- This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Cell Division Cycle, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus
-