RRM2 antibody (N-Term)
-
- Target See all RRM2 Antibodies
- RRM2 (Ribonucleotide Reductase M2 (RRM2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RRM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RRM2 antibody was raised against the N terminal of RRM2
- Purification
- Affinity purified
- Immunogen
- RRM2 antibody was raised using the N terminal of RRM2 corresponding to a region with amino acids PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP
- Top Product
- Discover our top product RRM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RRM2 Blocking Peptide, catalog no. 33R-6966, is also available for use as a blocking control in assays to test for specificity of this RRM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RRM2 (Ribonucleotide Reductase M2 (RRM2))
- Alternative Name
- RRM2 (RRM2 Products)
- Background
- RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases
-