NUP98 antibody (N-Term)

Catalog No. ABIN634181

Product Details anti-NUP98 Antibody

Target: NUP98 (Nucleoporin 98kDa (NUP98))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP98 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUP98 antibody was raised against the N terminal of NUP98

Purification: Affinity purified

Immunogen: NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP98 Blocking Peptide, catalog no. 33R-2374, is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP98 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP98

Target: NUP98 (Nucleoporin 98kDa (NUP98))

Alternative Name: NUP98 (NUP98 Products)

Synonyms: CG10198 antibody, CG10201 antibody, Dmel\\CG10198 antibody, Nup 96 antibody, Nup 98 antibody, Nup-98 antibody, Nup96 antibody, Nup98 antibody, Nup98-Nup96 antibody, Nup98/96 antibody, l(3)95BCd antibody, nup145 antibody, nup98-96 antibody, GB12688 antibody, NUP98 antibody, 4732457F17 antibody, AI849286 antibody, im:7151238 antibody, zgc:113968 antibody, zgc:63593 antibody, ADIR2 antibody, NUP196 antibody, NUP96 antibody, Nucleoporin 98-96kD antibody, nuclear pore complex protein Nup98-Nup96 antibody, nucleoporin 98 antibody, nucleoporin 98kDa antibody, nucleoporin 98 L homeolog antibody, Nup98-96 antibody, LOC408335 antibody, NUP98 antibody, LOC587580 antibody, Nup98 antibody, nup98 antibody, nup98.L antibody

Background: The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Protein targeting to Nucleus, SARS-CoV-2 Protein Interactome