SYCP1 antibody (N-Term)

Catalog No. ABIN634180

Product Details anti-SYCP1 Antibody

Target: SYCP1 (Synaptonemal Complex Protein 1 (SYCP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYCP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SYCP1 antibody was raised against the N terminal of SYCP1

Purification: Affinity purified

Immunogen: SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SYCP1 Blocking Peptide, catalog no. 33R-6689, is also available for use as a blocking control in assays to test for specificity of this SYCP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYCP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SYCP1

Target: SYCP1 (Synaptonemal Complex Protein 1 (SYCP1))

Alternative Name: SYCP1 (SYCP1 Products)

Synonyms: CT8 antibody, HOM-TES-14 antibody, SCP1 antibody, SYCP1 antibody, T16E15.12 antibody, T16E15_12 antibody, ZYP1 antibody, sycp1 antibody, SCP-1 antibody, syn1 antibody, synaptonemal complex protein 1 antibody, Myosin heavy chain-related protein antibody, SYCP1 antibody, sycp1 antibody, ZYP1a antibody, Sycp1 antibody

Background: SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.

Molecular Weight: 107 kDa (MW of target protein)