KIF12 antibody (N-Term)

Catalog No. ABIN634175

Product Details anti-KIF12 Antibody

Target: KIF12 (Kinesin Family Member 12 (KIF12))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF12 antibody was raised against the N terminal of KIF12

Purification: Affinity purified

Immunogen: KIF12 antibody was raised using the N terminal of KIF12 corresponding to a region with amino acids SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF12 Blocking Peptide, catalog no. 33R-8585, is also available for use as a blocking control in assays to test for specificity of this KIF12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF12

Target: KIF12 (Kinesin Family Member 12 (KIF12))

Alternative Name: KIF12 (KIF12 Products)

Synonyms: DDBDRAFT_0189854 antibody, DDBDRAFT_0201555 antibody, DDB_0189854 antibody, DDB_0201555 antibody, RP11-56P10.3 antibody, kinesin family member 12 antibody, KIF12 antibody, Bm1_06740 antibody, kif12 antibody, Kif12 antibody

Background: KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.

Molecular Weight: 56 kDa (MW of target protein)