KIF3A antibody (C-Term)
-
- Target See all KIF3A Antibodies
- KIF3A (Kinesin Family Member 3A (KIF3A))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF3A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIF3 A antibody was raised against the C terminal of KIF3
- Purification
- Affinity purified
- Immunogen
- KIF3 A antibody was raised using the C terminal of KIF3 corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR
- Top Product
- Discover our top product KIF3A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF3A Blocking Peptide, catalog no. 33R-7417, is also available for use as a blocking control in assays to test for specificity of this KIF3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF3A (Kinesin Family Member 3A (KIF3A))
- Alternative Name
- KIF3A (KIF3A Products)
- Background
- KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.
- Molecular Weight
- 80 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling
-