KIFC3 antibody (C-Term)

Catalog No. ABIN634173

Product Details anti-KIFC3 Antibody

Target: KIFC3 (Kinesin Family Member C3 (KIFC3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIFC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIFC3 antibody was raised against the C terminal of KIFC3

Purification: Affinity purified

Immunogen: KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIFC3 Blocking Peptide, catalog no. 33R-2452, is also available for use as a blocking control in assays to test for specificity of this KIFC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIFC3

Target: KIFC3 (Kinesin Family Member C3 (KIFC3))

Alternative Name: KIFC3 (KIFC3 Products)

Synonyms: fc51b05 antibody, si:ch211-160j6.2 antibody, wu:fc51b05 antibody, AI325457 antibody, BB123200 antibody, KRP4 antibody, kinesin family member C3 antibody, kifc3 antibody, KIFC3 antibody, Kifc3 antibody

Background: KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.

Molecular Weight: 93 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization